PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.02G311000.1.p
Common NameGLYMA_02G311000, LOC100792100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Nin-like
Protein Properties Length: 711aa    MW: 79084.3 Da    PI: 6.2548
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.02G311000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK90.61.2e-28496547152
               RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                          aek+isl +l++yF++++kdAAk++gvc+T+LKriCRq+GI RWP+Rkik++
  Glyma.02G311000.1.p 496 AEKTISLPVLRQYFAGSLKDAAKSIGVCPTTLKRICRQHGITRWPSRKIKKV 547
                          589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.291486567IPR003035RWP-RK domain
PfamPF020423.2E-24500547IPR003035RWP-RK domain
SuperFamilySSF542779.48E-22596690No hitNo description
Gene3DG3DSA:3.10.20.2401.1E-21601685No hitNo description
PROSITE profilePS5174520.399602688IPR000270PB1 domain
SMARTSM006662.6E-24602688IPR000270PB1 domain
PfamPF005643.3E-14603687IPR000270PB1 domain
CDDcd064075.72E-38603687No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 711 aa     Download sequence    Send to blast
MEYGAFGSLS ECEEDLIEEL LEKGCWVETN GSSEAQYDIE QELAMPMGKT TWWIGPKGPV  60
SGSSSSVKER LVVAVGYLRE YTKNNNAANV LIQIWVPIRR MTGLLAIGLG PDESVSVAFP  120
FPTNMNMNMK SNVNIRFFRS HEYPRIPYEY GSLALPVFER GSGTCLGVLQ IVMPAARWDT  180
INYLPQLDNN NNNNAFQGMI PGGVVKVFDE DEVYEASVNE MMEVVRCVCK TQNVPLALTW  240
APCVQQLCVD CGHSRDENNY VSIVDRACFV GDGQPQLLGF QEACSQHHLF RGQGIVGTAF  300
TTAKPCFAMD ITAFTKAEYP LSHHANIFDL HSAVAIPLRT SSYPHFDFVL EFFLPKHCPD  360
HNLFLNSLSI LLQQACPTFH LSAPIHDDVF TSLPSESQSQ QASWIAHMID AQSQHKDNGK  420
GVCLSLDFLE EEPKEEFKVT TTHCNWDTTA TSTYHSHDHV VFSDFGEESQ SQSQSQTHTF  480
GVKRGRKPGE KRRTKAEKTI SLPVLRQYFA GSLKDAAKSI GVCPTTLKRI CRQHGITRWP  540
SRKIKKVGHS LKKLQLVIDS VQGAEGAIQI GSFYNSFPEL SSRASQSSSP AAQSPPHVPQ  600
QPLRVKATFA DEKIRFSLQP LWGFTELQLE ISRRFNLSDV SNANNVVLKY LDDDGEWVVL  660
ACDGDLEECK DLHTTSQSRT IRLALFQASP LNNQPNSYTF ANTTSTPSSS *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003518588.10.0PREDICTED: protein NLP2-like
SwissprotQ7X9B91e-140NLP2_ARATH; Protein NLP2
TrEMBLI1JJW00.0I1JJW0_SOYBN; Uncharacterized protein
STRINGGLYMA02G48080.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12373399
Representative plantOGRP2991697
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35270.11e-131Nin-like family protein